Lineage for d4e5oc_ (4e5o C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972110Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2972567Protein automated matches [190469] (17 species)
    not a true protein
  7. 2972665Species Mouse (Mus musculus) [TaxId:10090] [225826] (11 PDB entries)
  8. 2972679Domain d4e5oc_: 4e5o C: [220316]
    automated match to d3ed7a_
    complexed with bu1, ump

Details for d4e5oc_

PDB Entry: 4e5o (more details), 1.7 Å

PDB Description: crystal structure of mouse thymidylate synthase in complex with dump
PDB Compounds: (C:) Thymidylate synthase

SCOPe Domain Sequences for d4e5oc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e5oc_ d.117.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rhgelqylrqvehilrcgfkkedrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvle
ellwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgpvygfqwrhfgaey
kdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalppchalcqfyvvng
elscqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlgdahiylnhieplk
iqlqreprpfpklkilrkvetiddfkvedfqiegynphpt

SCOPe Domain Coordinates for d4e5oc_:

Click to download the PDB-style file with coordinates for d4e5oc_.
(The format of our PDB-style files is described here.)

Timeline for d4e5oc_: