Lineage for d1bp3b1 (1bp3 B:202-300)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. Protein Prolactin receptor [49284] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [49285] (1 PDB entry)
  8. Domain d1bp3b1: 1bp3 B:202-300 [22031]
    Other proteins in same PDB: d1bp3a_
    complexed with zn

Details for d1bp3b1

PDB Entry: 1bp3 (more details), 2.9 Å

PDB Description: the xray structure of a growth hormone-prolactin receptor complex
PDB Compounds: (B:) protein (prolactin receptor)

SCOPe Domain Sequences for d1bp3b1:

Sequence, based on SEQRES records: (download)

>d1bp3b1 b.1.2.1 (B:202-300) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]}
lppgkpeifkcrspnketftcwwrpgtdgglptnysltyhregetlmhecpdyitggpns
chfgkqytsmwrtyimmvnatnqmgssfsdelyvdvtyi

Sequence, based on observed residues (ATOM records): (download)

>d1bp3b1 b.1.2.1 (B:202-300) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]}
lppgkpeifkcrspnketftcwwrpgtdgtnysltyhregetlmhecpdyitggpnschf
gkqytsmwrtyimmvnatnssfsdelyvdvtyi

SCOPe Domain Coordinates for d1bp3b1 are not available.

Timeline for d1bp3b1:

Domains from same chain:
(mouse over for more information)
d1bp3b2
Domains from other chains:
(mouse over for more information)
d1bp3a_