Lineage for d1cn4b2 (1cn4 B:117-225)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 222363Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 222364Family b.1.2.1: Fibronectin type III [49266] (18 proteins)
  6. 222387Protein Erythropoietin (EPO) receptor [49282] (1 species)
  7. 222388Species Human (Homo sapiens) [TaxId:9606] [49283] (5 PDB entries)
  8. 222408Domain d1cn4b2: 1cn4 B:117-225 [22030]
    Other proteins in same PDB: d1cn4c_
    mutant

Details for d1cn4b2

PDB Entry: 1cn4 (more details), 2.8 Å

PDB Description: erythropoietin complexed with extracellular domains of erythropoietin receptor

SCOP Domain Sequences for d1cn4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cn4b2 b.1.2.1 (B:117-225) Erythropoietin (EPO) receptor {Human (Homo sapiens)}
evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagqgagsvqrveile
grtecvlsnlrgrtrytfavrarmaepsfggfwsewsepvslltpsdld

SCOP Domain Coordinates for d1cn4b2:

Click to download the PDB-style file with coordinates for d1cn4b2.
(The format of our PDB-style files is described here.)

Timeline for d1cn4b2: