SCOP 1.57: Domain d1cn4b2: 1cn4 B:117-225

Lineage for d1cn4b2 (1cn4 B:117-225)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (16 proteins)

6. Protein Erythropoietin (EPO) receptor [49282] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49283] (5 PDB entries)

8. Domain d1cn4b2: 1cn4 B:117-225 [22030]
   Other proteins in same PDB: d1cn4c_

Details for d1cn4b2

PDB Entry: 1cn4, 2.8 Å

PDB Description: erythropoietin complexed with extracellular domains of erythropoietin receptor

SCOP Domain Sequences for d1cn4b2:

Sequence; same for both SEQRES and ATOM records:

>d1cn4b2 b.1.2.1 (B:117-225) Erythropoietin (EPO) receptor {Human (Homo sapiens)}
evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagqgagsvqrveile
grtecvlsnlrgrtrytfavrarmaepsfggfwsewsepvslltpsdld

Timeline for d1cn4b2:

• d1cn4b2 first appeared (with stable ids) in SCOP 1.55
  
• d1cn4b2 appears in SCOP 1.59
  
• d1cn4b2 appears in the current release, SCOPe 2.08