SCOPe 2.07: Domain d4e4ed2: 4e4e D:91-203

Lineage for d4e4ed2 (4e4e D:91-203)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (37 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226081] (2 PDB entries)

8. Domain d4e4ed2: 4e4e D:91-203 [220287]
   Other proteins in same PDB: d4e4ea1, d4e4eb1, d4e4ec1, d4e4ed1
   automated match to d1kkca2
   complexed with mn; mutant

Details for d4e4ed2

PDB Entry: 4e4e, 1.88 Å

PDB Description: Crystal Structure of the Y34F mutant of Saccharomyces cerevisiae Manganese Superoxide Dismutase

PDB Compounds: (D:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d4e4ed2:

Sequence; same for both SEQRES and ATOM records:

>d4e4ed2 d.44.1.0 (D:91-203) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
esqgggepptgalakaideqfgsldelikltntklagvqgsgwafivknlsnggkldvvq
tynqdtvtgplvplvaidawehayylqyqnkkadyfkaiwnvvnwkeasrrfd

Timeline for d4e4ed2:

• d4e4ed2 first appeared in SCOPe 2.03
  
• d4e4ed2 appears in SCOPe 2.06
  
• d4e4ed2 appears in the current release, SCOPe 2.08