SCOPe 2.08: Domain d4e4ed1: 4e4e D:1-90

Lineage for d4e4ed1 (4e4e D:1-90)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (39 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226080] (2 PDB entries)

8. Domain d4e4ed1: 4e4e D:1-90 [220286]
   Other proteins in same PDB: d4e4ea2, d4e4eb2, d4e4ec2, d4e4ed2
   automated match to d1kkca1
   complexed with mn; mutant

Details for d4e4ed1

PDB Entry: 4e4e, 1.88 Å

PDB Description: Crystal Structure of the Y34F mutant of Saccharomyces cerevisiae Manganese Superoxide Dismutase

PDB Compounds: (D:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d4e4ed1:

Sequence; same for both SEQRES and ATOM records:

>d4e4ed1 a.2.11.0 (D:1-90) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kvtlpdlkwdfgalepyisgqinelhytkhhqtfvngfntavdqfqelsdllakepspan
arkmiaiqqnikfhgggftnhclfwenlap

Timeline for d4e4ed1:

• d4e4ed1 first appeared in SCOPe 2.03
  
• d4e4ed1 appears in SCOPe 2.07