SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4e4ec1 (4e4e C:1-90)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979497Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1979785Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1980056Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 1980057Protein automated matches [226859] (31 species)
    not a true protein
  7. 1980098Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226080] (2 PDB entries)
  8. 1980105Domain d4e4ec1: 4e4e C:1-90 [220284]
    Other proteins in same PDB: d4e4ea2, d4e4eb2, d4e4ec2, d4e4ed2
    automated match to d1kkca1
    complexed with mn; mutant

Details for d4e4ec1

PDB Entry: 4e4e (more details), 1.88 Å

PDB Description: Crystal Structure of the Y34F mutant of Saccharomyces cerevisiae Manganese Superoxide Dismutase
PDB Compounds: (C:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d4e4ec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e4ec1 a.2.11.0 (C:1-90) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kvtlpdlkwdfgalepyisgqinelhytkhhqtfvngfntavdqfqelsdllakepspan
arkmiaiqqnikfhgggftnhclfwenlap

SCOPe Domain Coordinates for d4e4ec1:

Click to download the PDB-style file with coordinates for d4e4ec1.
(The format of our PDB-style files is described here.)

Timeline for d4e4ec1: