Class a: All alpha proteins [46456] (285 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (26 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226080] (2 PDB entries) |
Domain d4e4eb1: 4e4e B:1-90 [220282] Other proteins in same PDB: d4e4ea2, d4e4eb2, d4e4ec2, d4e4ed2 automated match to d1kkca1 complexed with mn; mutant |
PDB Entry: 4e4e (more details), 1.88 Å
SCOPe Domain Sequences for d4e4eb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e4eb1 a.2.11.0 (B:1-90) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kvtlpdlkwdfgalepyisgqinelhytkhhqtfvngfntavdqfqelsdllakepspan arkmiaiqqnikfhgggftnhclfwenlap
Timeline for d4e4eb1: