Lineage for d4e4ea2 (4e4e A:91-206)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513720Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2513721Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2514007Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2514008Protein automated matches [226860] (34 species)
    not a true protein
  7. 2514049Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226081] (2 PDB entries)
  8. 2514050Domain d4e4ea2: 4e4e A:91-206 [220281]
    Other proteins in same PDB: d4e4ea1, d4e4eb1, d4e4ec1, d4e4ed1
    automated match to d1kkca2
    complexed with mn; mutant

Details for d4e4ea2

PDB Entry: 4e4e (more details), 1.88 Å

PDB Description: Crystal Structure of the Y34F mutant of Saccharomyces cerevisiae Manganese Superoxide Dismutase
PDB Compounds: (A:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d4e4ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e4ea2 d.44.1.0 (A:91-206) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
esqgggepptgalakaideqfgsldelikltntklagvqgsgwafivknlsnggkldvvq
tynqdtvtgplvplvaidawehayylqyqnkkadyfkaiwnvvnwkeasrrfdagk

SCOPe Domain Coordinates for d4e4ea2:

Click to download the PDB-style file with coordinates for d4e4ea2.
(The format of our PDB-style files is described here.)

Timeline for d4e4ea2: