Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Erythropoietin (EPO) receptor [49282] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49283] (6 PDB entries) |
Domain d1cn4a2: 1cn4 A:117-223 [22028] Other proteins in same PDB: d1cn4c_ |
PDB Entry: 1cn4 (more details), 2.8 Å
SCOPe Domain Sequences for d1cn4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cn4a2 b.1.2.1 (A:117-223) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagqgagsvqrveile grtecvlsnlrgrtrytfavrarmaepsfggfwsewsepvslltpsd
Timeline for d1cn4a2: