Lineage for d1cn4a2 (1cn4 A:117-223)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 105235Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 105236Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 105259Protein Erythropoietin (EPO) receptor [49282] (1 species)
  7. 105260Species Human (Homo sapiens) [TaxId:9606] [49283] (5 PDB entries)
  8. 105278Domain d1cn4a2: 1cn4 A:117-223 [22028]
    Other proteins in same PDB: d1cn4c_

Details for d1cn4a2

PDB Entry: 1cn4 (more details), 2.8 Å

PDB Description: erythropoietin complexed with extracellular domains of erythropoietin receptor

SCOP Domain Sequences for d1cn4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cn4a2 b.1.2.1 (A:117-223) Erythropoietin (EPO) receptor {Human (Homo sapiens)}
evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagqgagsvqrveile
grtecvlsnlrgrtrytfavrarmaepsfggfwsewsepvslltpsd

SCOP Domain Coordinates for d1cn4a2:

Click to download the PDB-style file with coordinates for d1cn4a2.
(The format of our PDB-style files is described here.)

Timeline for d1cn4a2: