SCOPe 2.05: Domain d4e47c2: 4e47 C:194-369

Lineage for d4e47c2 (4e47 C:194-369)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.7: SET domain [82199] (4 families)
   duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
   also contains a substrate-binding alpha+beta subdomain inserted in the core

5. Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins)
   contains metal-binding preSET and postSET domains

6. Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82206] (17 PDB entries)
   Uniprot Q8WTS6 52-336

8. Domain d4e47c2: 4e47 C:194-369 [220277]
   Other proteins in same PDB: d4e47a1, d4e47b1, d4e47c1, d4e47d1
   automated match to d3cbpa2
   complexed with 0n6, bme, sam, so4

Details for d4e47c2

PDB Entry: 4e47, 2 Å

PDB Description: set7/9 in complex with inhibitor (r)-(3-(3-cyanophenyl)-1-oxo-1- (pyrrolidin-1-yl)propan-2-yl)-1,2,3,4-tetrahydroisoquinoline-6- sulfonamide and s-adenosylmethionine

PDB Compounds: (C:) Histone-lysine N-methyltransferase SETD7

SCOPe Domain Sequences for d4e47c2:

Sequence, based on SEQRES records:

>d4e47c2 b.85.7.1 (C:194-369) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydhsppgksgpeapewyqvelkafqatqqkhhh

Sequence, based on observed residues (ATOM records):

>d4e47c2 b.85.7.1 (C:194-369) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydhsapewyqvelkafqatqqkhhh

Timeline for d4e47c2:

• d4e47c2 first appeared in SCOPe 2.03
  
• d4e47c2 appears in SCOPe 2.04
  
• d4e47c2 appears in SCOPe 2.06
  
• d4e47c2 appears in the current release, SCOPe 2.08