Lineage for d4e47c2 (4e47 C:194-366)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818606Superfamily b.85.7: SET domain [82199] (4 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
    Pfam PF00856
  5. 2818607Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins)
    contains metal-binding preSET (Pfam PF05033) or AWS (Associated With SET, Pfam PF17907), and postSET domains
  6. 2818613Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species)
  7. 2818614Species Human (Homo sapiens) [TaxId:9606] [82206] (19 PDB entries)
    Uniprot Q8WTS6 52-336
  8. 2818633Domain d4e47c2: 4e47 C:194-366 [220277]
    Other proteins in same PDB: d4e47a1, d4e47a3, d4e47b1, d4e47b3, d4e47c1, d4e47c3, d4e47d1, d4e47d3
    automated match to d3cbpa2
    complexed with 0n6, bme, sam, so4

Details for d4e47c2

PDB Entry: 4e47 (more details), 2 Å

PDB Description: set7/9 in complex with inhibitor (r)-(3-(3-cyanophenyl)-1-oxo-1- (pyrrolidin-1-yl)propan-2-yl)-1,2,3,4-tetrahydroisoquinoline-6- sulfonamide and s-adenosylmethionine
PDB Compounds: (C:) Histone-lysine N-methyltransferase SETD7

SCOPe Domain Sequences for d4e47c2:

Sequence, based on SEQRES records: (download)

>d4e47c2 b.85.7.1 (C:194-366) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydhsppgksgpeapewyqvelkafqatqqk

Sequence, based on observed residues (ATOM records): (download)

>d4e47c2 b.85.7.1 (C:194-366) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydhsapewyqvelkafqatqqk

SCOPe Domain Coordinates for d4e47c2:

Click to download the PDB-style file with coordinates for d4e47c2.
(The format of our PDB-style files is described here.)

Timeline for d4e47c2: