Lineage for d4e47c1 (4e47 C:117-193)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1329352Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 1329380Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family) (S)
    11+ stranded sheet partly folded upon itself at the C-end
  5. 1329381Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)
  6. 1329382Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)
  7. 1329383Species Human (Homo sapiens) [TaxId:9606] [82188] (17 PDB entries)
    Uniprot Q8WTS6 52-366
  8. 1329395Domain d4e47c1: 4e47 C:117-193 [220276]
    Other proteins in same PDB: d4e47a2, d4e47b2, d4e47c2, d4e47d2
    automated match to d1n6ca1
    complexed with 0n6, bme, sam, so4

Details for d4e47c1

PDB Entry: 4e47 (more details), 2 Å

PDB Description: set7/9 in complex with inhibitor (r)-(3-(3-cyanophenyl)-1-oxo-1- (pyrrolidin-1-yl)propan-2-yl)-1,2,3,4-tetrahydroisoquinoline-6- sulfonamide and s-adenosylmethionine
PDB Compounds: (C:) Histone-lysine N-methyltransferase SETD7

SCOPe Domain Sequences for d4e47c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e47c1 b.76.2.1 (C:117-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmste
egrphfelmpgnsvyhf

SCOPe Domain Coordinates for d4e47c1:

Click to download the PDB-style file with coordinates for d4e47c1.
(The format of our PDB-style files is described here.)

Timeline for d4e47c1: