SCOPe 2.04: Domain d1cn4a1: 1cn4 A:7-116

Lineage for d1cn4a1 (1cn4 A:7-116)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Erythropoietin (EPO) receptor [49282] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49283] (6 PDB entries)

8. Domain d1cn4a1: 1cn4 A:7-116 [22027]
   Other proteins in same PDB: d1cn4c_

Details for d1cn4a1

PDB Entry: 1cn4, 2.8 Å

PDB Description: erythropoietin complexed with extracellular domains of erythropoietin receptor

PDB Compounds: (A:) protein (erythropoietin receptor)

SCOPe Domain Sequences for d1cn4a1:

Sequence; same for both SEQRES and ATOM records:

>d1cn4a1 b.1.2.1 (A:7-116) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}
pdpkfeskaallaargpeellcfterledlvcfweeaasagvgpgqysfsyqledepwkl
crlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

Timeline for d1cn4a1:

• d1cn4a1 first appeared (with stable ids) in SCOP 1.55
  
• d1cn4a1 appears in SCOPe 2.03
  
• d1cn4a1 appears in SCOPe 2.05
  
• d1cn4a1 appears in the current release, SCOPe 2.08