Lineage for d4e42c1 (4e42 C:1-110)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756411Domain d4e42c1: 4e42 C:1-110 [220268]
    Other proteins in same PDB: d4e42a2, d4e42b2, d4e42c2, d4e42d2
    automated match to d2f54d1
    complexed with cl, na, no3; mutant

Details for d4e42c1

PDB Entry: 4e42 (more details), 2.7 Å

PDB Description: Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor G4
PDB Compounds: (C:) T cell receptor G4 alpha chain

SCOPe Domain Sequences for d4e42c1:

Sequence, based on SEQRES records: (download)

>d4e42c1 b.1.1.0 (C:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrlsa
ttvaterysllyisssqttdsgvyfcavdrgstlgrlyfgrgtqltvwpd

Sequence, based on observed residues (ATOM records): (download)

>d4e42c1 b.1.1.0 (C:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrlsa
ttvaterysllyisssqttdsgvyfcavdrlyfgrgtqltvwpd

SCOPe Domain Coordinates for d4e42c1:

Click to download the PDB-style file with coordinates for d4e42c1.
(The format of our PDB-style files is described here.)

Timeline for d4e42c1: