| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
| Domain d4e42a2: 4e42 A:111-198 [220265] Other proteins in same PDB: d4e42a1, d4e42b1, d4e42c1, d4e42d1 automated match to d2f54d2 complexed with cl, na, no3; mutant |
PDB Entry: 4e42 (more details), 2.7 Å
SCOPe Domain Sequences for d4e42a2:
Sequence, based on SEQRES records: (download)
>d4e42a2 b.1.1.2 (A:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqkpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp
>d4e42a2 b.1.1.2 (A:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqkpdpavyqlrdsvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsn
ksdfacanafnnsiipedtffp
Timeline for d4e42a2: