Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (19 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries) |
Domain d4e41i1: 4e41 I:1-110 [220260] Other proteins in same PDB: d4e41a1, d4e41a2, d4e41b1, d4e41b2, d4e41d2, d4e41e2, d4e41f1, d4e41f2, d4e41g1, d4e41g2, d4e41i2, d4e41j2 automated match to d2f54d1 complexed with na; mutant |
PDB Entry: 4e41 (more details), 2.6 Å
SCOPe Domain Sequences for d4e41i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e41i1 b.1.1.0 (I:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrlsa ttvaterysllyisssqttdsgvyfcavdrgstlgrlyfgrgtqltvwpd
Timeline for d4e41i1: