Lineage for d1ebpb2 (1ebp B:117-220)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 54737Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 54738Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 54753Protein Erythropoietin (EPO) receptor [49282] (1 species)
  7. 54754Species Human (Homo sapiens) [TaxId:9606] [49283] (5 PDB entries)
  8. 54770Domain d1ebpb2: 1ebp B:117-220 [22026]
    Other proteins in same PDB: d1ebpc_, d1ebpd_

Details for d1ebpb2

PDB Entry: 1ebp (more details), 2.8 Å

PDB Description: complex between the extracellular domain of erythropoietin (epo) receptor [ebp] and an agonist peptide [emp1]

SCOP Domain Sequences for d1ebpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebpb2 b.1.2.1 (B:117-220) Erythropoietin (EPO) receptor {Human (Homo sapiens)}
evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveile
grtecvlsnlrgrtrytfavrarmaepsfggfwsawsepvsllt

SCOP Domain Coordinates for d1ebpb2:

Click to download the PDB-style file with coordinates for d1ebpb2.
(The format of our PDB-style files is described here.)

Timeline for d1ebpb2: