Lineage for d1ebpb2 (1ebp B:117-220)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761758Protein Erythropoietin (EPO) receptor [49282] (1 species)
  7. 2761759Species Human (Homo sapiens) [TaxId:9606] [49283] (6 PDB entries)
  8. 2761775Domain d1ebpb2: 1ebp B:117-220 [22026]
    Other proteins in same PDB: d1ebpc_, d1ebpd_

Details for d1ebpb2

PDB Entry: 1ebp (more details), 2.8 Å

PDB Description: complex between the extracellular domain of erythropoietin (epo) receptor [ebp] and an agonist peptide [emp1]
PDB Compounds: (B:) epo receptor

SCOPe Domain Sequences for d1ebpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebpb2 b.1.2.1 (B:117-220) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}
evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveile
grtecvlsnlrgrtrytfavrarmaepsfggfwsawsepvsllt

SCOPe Domain Coordinates for d1ebpb2:

Click to download the PDB-style file with coordinates for d1ebpb2.
(The format of our PDB-style files is described here.)

Timeline for d1ebpb2: