Lineage for d4e41f2 (4e41 F:82-181)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358644Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)
  7. 2358654Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries)
    Uniprot P01903 28-207
    probably orthologous to the mouse I-E group
  8. 2358675Domain d4e41f2: 4e41 F:82-181 [220257]
    Other proteins in same PDB: d4e41a1, d4e41b1, d4e41b2, d4e41d1, d4e41d2, d4e41e1, d4e41e2, d4e41f1, d4e41g1, d4e41g2, d4e41i1, d4e41i2, d4e41j1, d4e41j2
    automated match to d1jwua1
    complexed with na; mutant

Details for d4e41f2

PDB Entry: 4e41 (more details), 2.6 Å

PDB Description: Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor G4
PDB Compounds: (F:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d4e41f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e41f2 b.1.1.2 (F:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

SCOPe Domain Coordinates for d4e41f2:

Click to download the PDB-style file with coordinates for d4e41f2.
(The format of our PDB-style files is described here.)

Timeline for d4e41f2: