Lineage for d4e41e1 (4e41 E:1-110)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2033037Domain d4e41e1: 4e41 E:1-110 [220254]
    Other proteins in same PDB: d4e41a1, d4e41a2, d4e41b1, d4e41b2, d4e41d2, d4e41e2, d4e41f1, d4e41f2, d4e41g1, d4e41g2, d4e41i2, d4e41j2
    automated match to d2ak4e1
    complexed with na; mutant

Details for d4e41e1

PDB Entry: 4e41 (more details), 2.6 Å

PDB Description: Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor G4
PDB Compounds: (E:) T cell receptor G4 beta chain

SCOPe Domain Sequences for d4e41e1:

Sequence, based on SEQRES records: (download)

>d4e41e1 b.1.1.0 (E:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqspthliktrgqqatlrcspisghtsvywyqqalglglqfllwydegeernrgnfpp
rfsgrqfpnysselnvnaleledsalylcassqiretqyfgpgtrllvle

Sequence, based on observed residues (ATOM records): (download)

>d4e41e1 b.1.1.0 (E:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqspthliktrgqqatlrcspisghtsvywyqqalglqfllwydegeernrgnfpprf
sgrqfpnysselnvnaleledsalylcassqiretqyfgpgtrllvle

SCOPe Domain Coordinates for d4e41e1:

Click to download the PDB-style file with coordinates for d4e41e1.
(The format of our PDB-style files is described here.)

Timeline for d4e41e1: