Lineage for d4e41d1 (4e41 D:1-110)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765856Domain d4e41d1: 4e41 D:1-110 [220252]
    Other proteins in same PDB: d4e41a1, d4e41a2, d4e41b1, d4e41b2, d4e41d2, d4e41e2, d4e41f1, d4e41f2, d4e41g1, d4e41g2, d4e41i2, d4e41j2
    automated match to d2f54d1
    complexed with na; mutant

Details for d4e41d1

PDB Entry: 4e41 (more details), 2.6 Å

PDB Description: Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor G4
PDB Compounds: (D:) T cell receptor G4 alpha chain

SCOPe Domain Sequences for d4e41d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e41d1 b.1.1.0 (D:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrlsa
ttvaterysllyisssqttdsgvyfcavdrgstlgrlyfgrgtqltvwpd

SCOPe Domain Coordinates for d4e41d1:

Click to download the PDB-style file with coordinates for d4e41d1.
(The format of our PDB-style files is described here.)

Timeline for d4e41d1: