Lineage for d4e41b2 (4e41 B:93-190)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1515012Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 1515020Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (40 PDB entries)
    Uniprot P04229 30-219
    probably orthologous to the mouse I-E group
  8. 1515047Domain d4e41b2: 4e41 B:93-190 [220251]
    Other proteins in same PDB: d4e41a1, d4e41a2, d4e41b1, d4e41d1, d4e41d2, d4e41e1, d4e41e2, d4e41f1, d4e41f2, d4e41g1, d4e41i1, d4e41i2, d4e41j1, d4e41j2
    automated match to d1klub1
    complexed with na; mutant

Details for d4e41b2

PDB Entry: 4e41 (more details), 2.6 Å

PDB Description: Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor G4
PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d4e41b2:

Sequence, based on SEQRES records: (download)

>d4e41b2 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Sequence, based on observed residues (ATOM records): (download)

>d4e41b2 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsnllvcsvsgfypgsievrwfrngqeekagvvstgliqngdwtfqtlvm
letvprsgevytcqvehpsvtspltvewra

SCOPe Domain Coordinates for d4e41b2:

Click to download the PDB-style file with coordinates for d4e41b2.
(The format of our PDB-style files is described here.)

Timeline for d4e41b2: