SCOPe 2.07: Domain d1ebpb1: 1ebp B:10-116

Lineage for d1ebpb1 (1ebp B:10-116)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Erythropoietin (EPO) receptor [49282] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49283] (6 PDB entries)

8. Domain d1ebpb1: 1ebp B:10-116 [22025]
   Other proteins in same PDB: d1ebpc_, d1ebpd_

Details for d1ebpb1

PDB Entry: 1ebp, 2.8 Å

PDB Description: complex between the extracellular domain of erythropoietin (epo) receptor [ebp] and an agonist peptide [emp1]

PDB Compounds: (B:) epo receptor

SCOPe Domain Sequences for d1ebpb1:

Sequence; same for both SEQRES and ATOM records:

>d1ebpb1 b.1.2.1 (B:10-116) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}
kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

Timeline for d1ebpb1:

• d1ebpb1 first appeared (with stable ids) in SCOP 1.55
  
• d1ebpb1 appears in SCOPe 2.06
  
• d1ebpb1 appears in the current release, SCOPe 2.08