Lineage for d1ebpb1 (1ebp B:10-116)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 9780Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 9781Family b.1.2.1: Fibronectin type III [49266] (14 proteins)
  6. 9793Protein Erythropoietin (EPO) receptor [49282] (1 species)
  7. 9794Species Human (Homo sapiens) [TaxId:9606] [49283] (5 PDB entries)
  8. 9809Domain d1ebpb1: 1ebp B:10-116 [22025]
    Other proteins in same PDB: d1ebpc_, d1ebpd_

Details for d1ebpb1

PDB Entry: 1ebp (more details), 2.8 Å

PDB Description: complex between the extracellular domain of erythropoietin (epo) receptor [ebp] and an agonist peptide [emp1]

SCOP Domain Sequences for d1ebpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebpb1 b.1.2.1 (B:10-116) Erythropoietin (EPO) receptor {Human (Homo sapiens)}
kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

SCOP Domain Coordinates for d1ebpb1:

Click to download the PDB-style file with coordinates for d1ebpb1.
(The format of our PDB-style files is described here.)

Timeline for d1ebpb1: