SCOP 1.61: Domain d1ebpa2: 1ebp A:117-220

Lineage for d1ebpa2 (1ebp A:117-220)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (16 proteins)

6. Protein Erythropoietin (EPO) receptor [49282] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49283] (5 PDB entries)

8. Domain d1ebpa2: 1ebp A:117-220 [22024]
   Other proteins in same PDB: d1ebpc_, d1ebpd_

Details for d1ebpa2

PDB Entry: 1ebp, 2.8 Å

PDB Description: complex between the extracellular domain of erythropoietin (epo) receptor [ebp] and an agonist peptide [emp1]

SCOP Domain Sequences for d1ebpa2:

Sequence; same for both SEQRES and ATOM records:

>d1ebpa2 b.1.2.1 (A:117-220) Erythropoietin (EPO) receptor {Human (Homo sapiens)}
evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveile
grtecvlsnlrgrtrytfavrarmaepsfggfwsawsepvsllt

Timeline for d1ebpa2:

• d1ebpa2 first appeared (with stable ids) in SCOP 1.55
  
• d1ebpa2 appears in SCOP 1.59
  
• d1ebpa2 appears in SCOP 1.63
  
• d1ebpa2 appears in the current release, SCOPe 2.08