Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Erythropoietin (EPO) receptor [49282] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49283] (6 PDB entries) |
Domain d1ebpa1: 1ebp A:10-116 [22023] Other proteins in same PDB: d1ebpc_, d1ebpd_ |
PDB Entry: 1ebp (more details), 2.8 Å
SCOPe Domain Sequences for d1ebpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ebpa1 b.1.2.1 (A:10-116) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin
Timeline for d1ebpa1:
View in 3D Domains from other chains: (mouse over for more information) d1ebpb1, d1ebpb2, d1ebpc_, d1ebpd_ |