Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (63 species) not a true protein |
Species Vibrionales bacterium [TaxId:391574] [226335] (1 PDB entry) |
Domain d4e38c_: 4e38 C: [220229] automated match to d1mxsa_ complexed with cl |
PDB Entry: 4e38 (more details), 1.64 Å
SCOPe Domain Sequences for d4e38c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e38c_ c.1.10.0 (C:) automated matches {Vibrionales bacterium [TaxId: 391574]} hhssgvdlgtenlyfqsmmstinnqlkalkvipviaidnaediiplgkvlaenglpaaei tfrsdaaveairllrqaqpemligagtilngeqalaakeagatfvvspgfnpntvracqe igidivpgvnnpstveaalemglttlkffpaeasggismvkslvgpygdirlmptggitp snidnylaipqvlacggtwmvdkklvtngewdeiarltreiveqvnp
Timeline for d4e38c_: