| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (18 proteins) |
| Protein Erythropoietin (EPO) receptor [49282] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49283] (5 PDB entries) |
| Domain d1ernb2: 1ern B:117-222 [22022] |
PDB Entry: 1ern (more details), 2.4 Å
SCOP Domain Sequences for d1ernb2:
Sequence, based on SEQRES records: (download)
>d1ernb2 b.1.2.1 (B:117-222) Erythropoietin (EPO) receptor {Human (Homo sapiens)}
evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveile
grtecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltps
>d1ernb2 b.1.2.1 (B:117-222) Erythropoietin (EPO) receptor {Human (Homo sapiens)}
evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsaggagsvqrveileg
rtecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltps
Timeline for d1ernb2: