SCOP 1.63: Domain d1ernb2: 1ern B:117-222

Lineage for d1ernb2 (1ern B:117-222)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (18 proteins)

6. Protein Erythropoietin (EPO) receptor [49282] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49283] (5 PDB entries)

8. Domain d1ernb2: 1ern B:117-222 [22022]

Details for d1ernb2

PDB Entry: 1ern, 2.4 Å

PDB Description: native structure of the extracellular domain of erythropoietin (epo) receptor [ebp]

SCOP Domain Sequences for d1ernb2:

Sequence, based on SEQRES records:

>d1ernb2 b.1.2.1 (B:117-222) Erythropoietin (EPO) receptor {Human (Homo sapiens)}
evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveile
grtecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltps

Sequence, based on observed residues (ATOM records):

>d1ernb2 b.1.2.1 (B:117-222) Erythropoietin (EPO) receptor {Human (Homo sapiens)}
evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsaggagsvqrveileg
rtecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltps

Timeline for d1ernb2:

• d1ernb2 first appeared (with stable ids) in SCOP 1.55
  
• d1ernb2 appears in SCOP 1.61
  
• d1ernb2 appears in SCOP 1.65
  
• d1ernb2 appears in the current release, SCOPe 2.08