Lineage for d1ernb2 (1ern B:117-222)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 54737Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 54738Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 54753Protein Erythropoietin (EPO) receptor [49282] (1 species)
  7. 54754Species Human (Homo sapiens) [TaxId:9606] [49283] (5 PDB entries)
  8. 54766Domain d1ernb2: 1ern B:117-222 [22022]

Details for d1ernb2

PDB Entry: 1ern (more details), 2.4 Å

PDB Description: native structure of the extracellular domain of erythropoietin (epo) receptor [ebp]

SCOP Domain Sequences for d1ernb2:

Sequence, based on SEQRES records: (download)

>d1ernb2 b.1.2.1 (B:117-222) Erythropoietin (EPO) receptor {Human (Homo sapiens)}
evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveile
grtecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltps

Sequence, based on observed residues (ATOM records): (download)

>d1ernb2 b.1.2.1 (B:117-222) Erythropoietin (EPO) receptor {Human (Homo sapiens)}
evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsaggagsvqrveileg
rtecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltps

SCOP Domain Coordinates for d1ernb2:

Click to download the PDB-style file with coordinates for d1ernb2.
(The format of our PDB-style files is described here.)

Timeline for d1ernb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ernb1