SCOPe 2.08: Domain d1ernb2: 1ern B:117-222

Lineage for d1ernb2 (1ern B:117-222)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Erythropoietin (EPO) receptor [49282] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49283] (6 PDB entries)

8. Domain d1ernb2: 1ern B:117-222 [22022]

Details for d1ernb2

PDB Entry: 1ern, 2.4 Å

PDB Description: native structure of the extracellular domain of erythropoietin (epo) receptor [ebp]

PDB Compounds: (B:) protein (erythropoietin receptor)

SCOPe Domain Sequences for d1ernb2:

Sequence, based on SEQRES records:

>d1ernb2 b.1.2.1 (B:117-222) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}
evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveile
grtecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltps

Sequence, based on observed residues (ATOM records):

>d1ernb2 b.1.2.1 (B:117-222) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}
evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsaggagsvqrveileg
rtecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltps

Timeline for d1ernb2:

• d1ernb2 first appeared (with stable ids) in SCOP 1.55
  
• d1ernb2 appears in SCOPe 2.07