Lineage for d1ernb1 (1ern B:10-116)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761758Protein Erythropoietin (EPO) receptor [49282] (1 species)
  7. 2761759Species Human (Homo sapiens) [TaxId:9606] [49283] (6 PDB entries)
  8. 2761766Domain d1ernb1: 1ern B:10-116 [22021]

Details for d1ernb1

PDB Entry: 1ern (more details), 2.4 Å

PDB Description: native structure of the extracellular domain of erythropoietin (epo) receptor [ebp]
PDB Compounds: (B:) protein (erythropoietin receptor)

SCOPe Domain Sequences for d1ernb1:

Sequence, based on SEQRES records: (download)

>d1ernb1 b.1.2.1 (B:10-116) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}
kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

Sequence, based on observed residues (ATOM records): (download)

>d1ernb1 b.1.2.1 (B:10-116) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}
kfeskaallaaeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrlhqa
ptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

SCOPe Domain Coordinates for d1ernb1:

Click to download the PDB-style file with coordinates for d1ernb1.
(The format of our PDB-style files is described here.)

Timeline for d1ernb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ernb2