Lineage for d4e2qo_ (4e2q O:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070601Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2070602Protein automated matches [190388] (22 species)
    not a true protein
  7. 2070736Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [226353] (2 PDB entries)
  8. 2070767Domain d4e2qo_: 4e2q O: [220207]
    automated match to d1sfna_
    complexed with mn

Details for d4e2qo_

PDB Entry: 4e2q (more details), 2.5 Å

PDB Description: Crystal Structure of (S)-Ureidoglycine Aminohydrolase from Arabidopsis thaliana
PDB Compounds: (O:) Ureidoglycine aminohydrolase

SCOPe Domain Sequences for d4e2qo_:

Sequence, based on SEQRES records: (download)

>d4e2qo_ b.82.1.0 (O:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
gshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyaylppnfh
hsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydf
nihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwya
algktrsryllykdvnrnpl

Sequence, based on observed residues (ATOM records): (download)

>d4e2qo_ b.82.1.0 (O:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
gktrsryllykdvnrnpl

SCOPe Domain Coordinates for d4e2qo_:

Click to download the PDB-style file with coordinates for d4e2qo_.
(The format of our PDB-style files is described here.)

Timeline for d4e2qo_: