SCOPe 2.06: Domain d1erna2: 1ern A:117-221

Lineage for d1erna2 (1ern A:117-221)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Erythropoietin (EPO) receptor [49282] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49283] (6 PDB entries)

8. Domain d1erna2: 1ern A:117-221 [22020]

Details for d1erna2

PDB Entry: 1ern, 2.4 Å

PDB Description: native structure of the extracellular domain of erythropoietin (epo) receptor [ebp]

PDB Compounds: (A:) protein (erythropoietin receptor)

SCOPe Domain Sequences for d1erna2:

Sequence, based on SEQRES records:

>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}
evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveile
grtecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltp

Sequence, based on observed residues (ATOM records):

>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}
evvlldapvglvarladeghvvlrwlpppetpmtshiryevdvsaggagsvqrveilegr
tecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltp

Timeline for d1erna2:

• d1erna2 first appeared (with stable ids) in SCOP 1.55
  
• d1erna2 appears in SCOPe 2.05
  
• d1erna2 appears in SCOPe 2.07
  
• d1erna2 appears in the current release, SCOPe 2.08