Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Erythropoietin (EPO) receptor [49282] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49283] (6 PDB entries) |
Domain d1erna2: 1ern A:117-221 [22020] |
PDB Entry: 1ern (more details), 2.4 Å
SCOPe Domain Sequences for d1erna2:
Sequence, based on SEQRES records: (download)
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveile grtecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltp
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} evvlldapvglvarladeghvvlrwlpppetpmtshiryevdvsaggagsvqrveilegr tecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltp
Timeline for d1erna2: