Lineage for d4e2fl1 (4e2f L:10-100)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906648Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) (S)
    automatically mapped to Pfam PF01948
  5. 1906649Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 1906650Protein Aspartate carbamoyltransferase [54895] (3 species)
  7. 1906651Species Escherichia coli [TaxId:562] [54896] (60 PDB entries)
    Uniprot P00478
  8. 1906749Domain d4e2fl1: 4e2f L:10-100 [220191]
    Other proteins in same PDB: d4e2fa1, d4e2fa2, d4e2fb2, d4e2fc1, d4e2fc2, d4e2fd2, d4e2fe1, d4e2fe2, d4e2ff2, d4e2fg1, d4e2fg2, d4e2fh2, d4e2fi1, d4e2fi2, d4e2fj2, d4e2fk1, d4e2fk2, d4e2fl2
    automated match to d1d09b1
    complexed with zn; mutant

Details for d4e2fl1

PDB Entry: 4e2f (more details), 2.8 Å

PDB Description: Crystal Structure of E. coli Aspartate Transcarbamoylase K164E/E239K Mutant in an intermediate state
PDB Compounds: (L:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d4e2fl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e2fl1 d.58.2.1 (L:10-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
eaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflsed
qvdqlalyapqatvnridnyevvgksrpslp

SCOPe Domain Coordinates for d4e2fl1:

Click to download the PDB-style file with coordinates for d4e2fl1.
(The format of our PDB-style files is described here.)

Timeline for d4e2fl1: