SCOP 1.63: Domain d1erna1: 1ern A:10-116

Lineage for d1erna1 (1ern A:10-116)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (18 proteins)

6. Protein Erythropoietin (EPO) receptor [49282] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49283] (5 PDB entries)

8. Domain d1erna1: 1ern A:10-116 [22019]

Details for d1erna1

PDB Entry: 1ern, 2.4 Å

PDB Description: native structure of the extracellular domain of erythropoietin (epo) receptor [ebp]

SCOP Domain Sequences for d1erna1:

Sequence, based on SEQRES records:

>d1erna1 b.1.2.1 (A:10-116) Erythropoietin (EPO) receptor {Human (Homo sapiens)}
kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

Sequence, based on observed residues (ATOM records):

>d1erna1 b.1.2.1 (A:10-116) Erythropoietin (EPO) receptor {Human (Homo sapiens)}
kfeskaallaaeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrlhqa
ptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

Timeline for d1erna1:

• d1erna1 first appeared (with stable ids) in SCOP 1.55
  
• d1erna1 appears in SCOP 1.61
  
• d1erna1 appears in SCOP 1.65
  
• d1erna1 appears in the current release, SCOPe 2.08