Lineage for d1erna1 (1ern A:10-116)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 160936Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 160937Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 160960Protein Erythropoietin (EPO) receptor [49282] (1 species)
  7. 160961Species Human (Homo sapiens) [TaxId:9606] [49283] (5 PDB entries)
  8. 160966Domain d1erna1: 1ern A:10-116 [22019]

Details for d1erna1

PDB Entry: 1ern (more details), 2.4 Å

PDB Description: native structure of the extracellular domain of erythropoietin (epo) receptor [ebp]

SCOP Domain Sequences for d1erna1:

Sequence, based on SEQRES records: (download)

>d1erna1 b.1.2.1 (A:10-116) Erythropoietin (EPO) receptor {Human (Homo sapiens)}
kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

Sequence, based on observed residues (ATOM records): (download)

>d1erna1 b.1.2.1 (A:10-116) Erythropoietin (EPO) receptor {Human (Homo sapiens)}
kfeskaallaaeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrlhqa
ptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

SCOP Domain Coordinates for d1erna1:

Click to download the PDB-style file with coordinates for d1erna1.
(The format of our PDB-style files is described here.)

Timeline for d1erna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1erna2