SCOPe 2.06: Domain d4e2fh1: 4e2f H:10-100

Lineage for d4e2fh1 (4e2f H:10-100)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families)
   automatically mapped to Pfam PF01948

5. Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)

6. Protein Aspartate carbamoyltransferase [54895] (3 species)

7. Species Escherichia coli [TaxId:562] [54896] (60 PDB entries)
   Uniprot P00478

8. Domain d4e2fh1: 4e2f H:10-100 [220183]
   Other proteins in same PDB: d4e2fa1, d4e2fa2, d4e2fb2, d4e2fc1, d4e2fc2, d4e2fd2, d4e2fe1, d4e2fe2, d4e2ff2, d4e2fg1, d4e2fg2, d4e2fh2, d4e2fi1, d4e2fi2, d4e2fj2, d4e2fk1, d4e2fk2, d4e2fl2
   automated match to d1d09b1
   complexed with zn; mutant

Details for d4e2fh1

PDB Entry: 4e2f, 2.8 Å

PDB Description: Crystal Structure of E. coli Aspartate Transcarbamoylase K164E/E239K Mutant in an intermediate state

PDB Compounds: (H:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d4e2fh1:

Sequence; same for both SEQRES and ATOM records:

>d4e2fh1 d.58.2.1 (H:10-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
eaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflsed
qvdqlalyapqatvnridnyevvgksrpslp

Timeline for d4e2fh1:

• d4e2fh1 first appeared in SCOPe 2.03
  
• d4e2fh1 appears in SCOPe 2.05
  
• d4e2fh1 appears in SCOPe 2.07
  
• d4e2fh1 appears in the current release, SCOPe 2.08