![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (1 family) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (44 proteins) Pfam PF00041 |
![]() | Protein Erythropoietin (EPO) receptor [49282] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49283] (5 PDB entries) |
![]() | Domain d1ebab1: 1eba B:10-116 [22017] |
PDB Entry: 1eba (more details), 2.7 Å
SCOP Domain Sequences for d1ebab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ebab1 b.1.2.1 (B:10-116) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin
Timeline for d1ebab1: