Lineage for d1ebab1 (1eba B:10-116)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 160936Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 160937Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 160960Protein Erythropoietin (EPO) receptor [49282] (1 species)
  7. 160961Species Human (Homo sapiens) [TaxId:9606] [49283] (5 PDB entries)
  8. 160972Domain d1ebab1: 1eba B:10-116 [22017]

Details for d1ebab1

PDB Entry: 1eba (more details), 2.7 Å

PDB Description: complex between the extracellular domain of erythropoietin (epo) receptor [ebp] and an inactive peptide [emp33] contains 3,5-dibromotyrosine in position 4 (denoted dby)

SCOP Domain Sequences for d1ebab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebab1 b.1.2.1 (B:10-116) Erythropoietin (EPO) receptor {Human (Homo sapiens)}
kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

SCOP Domain Coordinates for d1ebab1:

Click to download the PDB-style file with coordinates for d1ebab1.
(The format of our PDB-style files is described here.)

Timeline for d1ebab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ebab2