SCOPe 2.04: Domain d4e2fa1: 4e2f A:1-150

Lineage for d4e2fa1 (4e2f A:1-150)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (6 species)

7. Species Escherichia coli [TaxId:562] [53674] (63 PDB entries)
   Uniprot P00479

8. Domain d4e2fa1: 4e2f A:1-150 [220169]
   Other proteins in same PDB: d4e2fb1, d4e2fb2, d4e2fd1, d4e2fd2, d4e2ff1, d4e2ff2, d4e2fh1, d4e2fh2, d4e2fj1, d4e2fj2, d4e2fl1, d4e2fl2
   automated match to d1ekxa1
   complexed with zn; mutant

Details for d4e2fa1

PDB Entry: 4e2f, 2.8 Å

PDB Description: Crystal Structure of E. coli Aspartate Transcarbamoylase K164E/E239K Mutant in an intermediate state

PDB Compounds: (A:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d4e2fa1:

Sequence; same for both SEQRES and ATOM records:

>d4e2fa1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

Timeline for d4e2fa1:

• d4e2fa1 first appeared in SCOPe 2.03
  
• d4e2fa1 appears in SCOPe 2.05
  
• d4e2fa1 appears in the current release, SCOPe 2.08