SCOPe 2.06: Domain d4e2ba_: 4e2b A:

Lineage for d4e2ba_ (4e2b A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.0: automated matches [191310] (1 protein)
   not a true family

6. Protein automated matches [190048] (21 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:5693] [189890] (4 PDB entries)

8. Domain d4e2ba_: 4e2b A: [220168]
   automated match to d4e2da_
   complexed with fmn, gol, peg

Details for d4e2ba_

PDB Entry: 4e2b, 1.27 Å

PDB Description: High resolution crystal structure of the old yellow enzyme from Trypanosoma cruzi

PDB Compounds: (A:) old yellow enzyme

SCOPe Domain Sequences for d4e2ba_:

Sequence; same for both SEQRES and ATOM records:

>d4e2ba_ c.1.4.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
matfpellrplklgrytlrnriimapltrcqatedghvprtesmlkyyedrasagliiae
atmvqpnytgfltepgiysdaqieewrkivdavhkkggliflqlihagragipekilqqp
ksdqdplagrllaasaipikdhripayfaasgeketygvpeeltddevrngiiplfvega
knaifkagfdgveihgangylldaffressnkrqsgpyagttidtrcqliydvtksvcda
vgsdrvglrisplngvhgmidsnpealtkhlckkieplslaylhylrgdmvnqqigdvva
wvrgsysgvkisnlrydfeeadqqiregkvdavafgakfianpdlveraqhdwplneprp
etyytrtavgyndyptyn

Timeline for d4e2ba_:

• d4e2ba_ first appeared in SCOPe 2.03
  
• d4e2ba_ appears in SCOPe 2.05
  
• d4e2ba_ appears in SCOPe 2.07
  
• d4e2ba_ appears in the current release, SCOPe 2.08