![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) |
![]() | Protein automated matches [190209] (5 species) not a true protein |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11698] [195546] (4 PDB entries) |
![]() | Domain d4e1ma_: 4e1m A: [220163] automated match to d4e1na_ complexed with tq2 |
PDB Entry: 4e1m (more details), 1.9 Å
SCOPe Domain Sequences for d4e1ma_:
Sequence, based on SEQRES records: (download)
>d4e1ma_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]} cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht dngsnftsatvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlkta vqmavfihnkkrkggiggysagerivdiiatd
>d4e1ma_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]} cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht dngsnftsatvkaacwwagikqefgipnpqsqgviesmnkelkkiigqvrdqaehlktav qmavfihnkkrkggysagerivdiiatd
Timeline for d4e1ma_: