Lineage for d4e1ma_ (4e1m A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1373755Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1374020Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 1374128Protein automated matches [190209] (5 species)
    not a true protein
  7. 1374255Species Human immunodeficiency virus type 1 [TaxId:11698] [195546] (4 PDB entries)
  8. 1374257Domain d4e1ma_: 4e1m A: [220163]
    automated match to d4e1na_
    complexed with tq2

Details for d4e1ma_

PDB Entry: 4e1m (more details), 1.9 Å

PDB Description: crystal structure of hiv-1 integrase with a non-catayltic site inhibitor
PDB Compounds: (A:) hiv-1 integrase

SCOPe Domain Sequences for d4e1ma_:

Sequence, based on SEQRES records: (download)

>d4e1ma_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsatvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnkkrkggiggysagerivdiiatd

Sequence, based on observed residues (ATOM records): (download)

>d4e1ma_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsatvkaacwwagikqefgipnpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnkkrkggysagerivdiiatd

SCOPe Domain Coordinates for d4e1ma_:

Click to download the PDB-style file with coordinates for d4e1ma_.
(The format of our PDB-style files is described here.)

Timeline for d4e1ma_: