![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein Erythropoietin (EPO) receptor [49282] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49283] (6 PDB entries) |
![]() | Domain d1ebaa2: 1eba A:117-224 [22016] |
PDB Entry: 1eba (more details), 2.7 Å
SCOPe Domain Sequences for d1ebaa2:
Sequence, based on SEQRES records: (download)
>d1ebaa2 b.1.2.1 (A:117-224) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveile grtecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltpsdl
>d1ebaa2 b.1.2.1 (A:117-224) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsaggsvqrveilegrt ecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltpsdl
Timeline for d1ebaa2: