Lineage for d4e1jc2 (4e1j C:275-519)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885561Species Sinorhizobium meliloti [TaxId:266834] [226334] (1 PDB entry)
  8. 2885567Domain d4e1jc2: 4e1j C:275-519 [220152]
    Other proteins in same PDB: d4e1ja3, d4e1jc3
    automated match to d3ezwd2
    complexed with cl, gol, na

Details for d4e1jc2

PDB Entry: 4e1j (more details), 2.33 Å

PDB Description: crystal structure of glycerol kinase in complex with glycerol from sinorhizobium meliloti 1021
PDB Compounds: (C:) glycerol kinase

SCOPe Domain Sequences for d4e1jc2:

Sequence, based on SEQRES records: (download)

>d4e1jc2 c.55.1.0 (C:275-519) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
acfkpgmlkstygtgcfallntgkdmvrsknrllttiayrldgettyalegsifvagaav
qwlrdglkvikaapdtgslaesadpsqevylvpaftglgaphwdpdargaifgmtrntgp
aefaraaleavcyqtrdlleamhkdwrrngndtvlrvdggmvasdwtmqrlsdlldapvd
rpvilettalgvawlagsragvwpnqeafakswardrrfephmdeatrkvklkgwrsavk
rtlia

Sequence, based on observed residues (ATOM records): (download)

>d4e1jc2 c.55.1.0 (C:275-519) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
acfkpgmlkstygtgcfallntgkdmvrsknrllttiayrldgettyalegsifvagaav
qwlrdglkvitgslaesadpsqevylvpaftglgaphwdpdargaifgmtrntgpaefar
aaleavcyqtrdlleamhkdwrtvlrvdggmvasdwtmqrlsdlldapvdrpvilettal
gvawlagsragvwpnqeafakswardrrfephmdeatrkvklkgwrsavkrtlia

SCOPe Domain Coordinates for d4e1jc2:

Click to download the PDB-style file with coordinates for d4e1jc2.
(The format of our PDB-style files is described here.)

Timeline for d4e1jc2: