Lineage for d4e1jb1 (4e1j B:26-274)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858517Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1858518Protein automated matches [226839] (49 species)
    not a true protein
  7. 1858935Species Sinorhizobium meliloti [TaxId:266834] [226334] (1 PDB entry)
  8. 1858938Domain d4e1jb1: 4e1j B:26-274 [220149]
    automated match to d1glfo1
    complexed with cl, gol, na

Details for d4e1jb1

PDB Entry: 4e1j (more details), 2.33 Å

PDB Description: crystal structure of glycerol kinase in complex with glycerol from sinorhizobium meliloti 1021
PDB Compounds: (B:) glycerol kinase

SCOPe Domain Sequences for d4e1jb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e1jb1 c.55.1.0 (B:26-274) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
gyilaidqgttstraivfdgnqkiagvgqkefkqhfpksgwvehdpeeiwqtvvstvkea
ieksgitandiaaigitnqretvvvwdretgkpihnaivwqdrrtaafcdklkkkglekt
fvkktgllldpyfsgtklnwllsnvkgaqvraakgelcfgtidtfliwrltggecfctda
tnasrtllyniaenawddeltevlrvpkemlpevkdcaadfgvtdpslfgaaipilgvag
dqqaatigq

SCOPe Domain Coordinates for d4e1jb1:

Click to download the PDB-style file with coordinates for d4e1jb1.
(The format of our PDB-style files is described here.)

Timeline for d4e1jb1: