![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) ![]() |
![]() | Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins) possible duplication: contains several domains of this fold The listed PDB entries contain different large fragments but not the whole proteins |
![]() | Protein automated matches [226863] (2 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [225109] (3 PDB entries) |
![]() | Domain d4e18a1: 4e18 A:1-128 [220145] Other proteins in same PDB: d4e18a3 automated match to d1syqa1 |
PDB Entry: 4e18 (more details), 2.4 Å
SCOPe Domain Sequences for d4e18a1:
Sequence, based on SEQRES records: (download)
>d4e18a1 a.24.9.1 (A:1-128) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} mpvfhtrtiesilepvaqqishlvimheegevdgkaipdltapvsavqaavsnlvrvgke tvqttedqilkrdmppafikvenactklvraaqmlqadpysvpardylidgsrgilsgts dllltfde
>d4e18a1 a.24.9.1 (A:1-128) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} mpvfhtrtiesilepvaqqishlvimheegegkaipdltapvsavqaavsnlvrvgketv qttedqilkrdmppafikvenactklvraaqmlqadpysvpardylidgsrgilsgtsdl lltfde
Timeline for d4e18a1: