SCOPe 2.06: Domain d4e17a2: 4e17 A:129-254

Lineage for d4e17a2 (4e17 A:129-254)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families)

5. Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
   possible duplication: contains several domains of this fold
   The listed PDB entries contain different large fragments but not the whole proteins

6. Protein automated matches [226863] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225109] (3 PDB entries)

8. Domain d4e17a2: 4e17 A:129-254 [220144]
   Other proteins in same PDB: d4e17a3
   automated match to d1rkea2

Details for d4e17a2

PDB Entry: 4e17, 2.3 Å

PDB Description: Alpha-E-catenin is an autoinhibited molecule that co-activates vinculin

PDB Compounds: (A:) vinculin

SCOPe Domain Sequences for d4e17a2:

Sequence, based on SEQRES records:

>d4e17a2 a.24.9.1 (A:129-254) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
aevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderqqelthqehr
vmlvnsmntvkellpvlisamkifvttkntksqgieealknrnftvekmsaeineiirvl
qltswd

Sequence, based on observed residues (ATOM records):

>d4e17a2 a.24.9.1 (A:129-254) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
aevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderqqelthqehr
vmlvnsmntvkellpvlisamkifvttkgieealknrnftvekmsaeineiirvlqltsw
d

Timeline for d4e17a2:

• d4e17a2 first appeared in SCOPe 2.03
  
• d4e17a2 appears in SCOPe 2.05
  
• d4e17a2 appears in SCOPe 2.07
  
• d4e17a2 appears in the current release, SCOPe 2.08